{"product_id":"proteintech-16691-1-ap","title":"Proteintech, 16691-1-AP, GPR180 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR180 (16691-1-AP) by Proteintech is a Polyclonal antibody targeting GPR180 in WB, ELISA applications with reactivity to human samples\n16691-1-AP targets GPR180 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR180 is an orphan GPCR, also known as the Endothelial Thickness-Related Receptor (ITR), and is a member of the GOLDS domain seven transmembrane helix (GOST) protein family. This receptor was initially discovered to promote the proliferation of vascular smooth muscle cells, leading to subsequent thickening of the vascular intima. GPR180 interacts with CTHRC1 to regulate the TGFβ signaling pathway, influencing energy metabolism and thermogenic function ( PMID: 34880217).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10052 Product name: Recombinant human GPR180 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-170 aa of BC052243 Sequence: QGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGESGL Predict reactive species\nFull Name: G protein-coupled receptor 180\nCalculated Molecular Weight: 440 aa, 49 kDa\nGenBank Accession Number: BC052243\nGene Symbol: GPR180\nGene ID (NCBI): 160897\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86V85\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657275561,"sku":"16691-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16691-1-ap","provider":"Iright","version":"1.0","type":"link"}