{"product_id":"proteintech-16696-1-ap","title":"Proteintech, 16696-1-AP, CA13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CA13 (16696-1-AP) by Proteintech is a Polyclonal antibody targeting CA13 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16696-1-AP targets CA13 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells,  mouse skeletal muscle tissue\nPositive IHC detected in: human placenta tissue,  human heart tissue,  human kidney tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarbonic anhydrases (CAs) are zinc-containing metalloenzymes that catalyze the reversible hydration of carbon dioxide. The mammalian α-CA gene family has been reported to include at least eleven enzymatically active isoforms with different structural and catalytic properties. Four of the active CA isozymes are cytosolic (CA I, II, III, and VII), four are membrane-associated(CA IV, IX, XII, and XIV), two are mitochondrial (CA VA and VB), and one is a secretory form (CA VI). CA13 is a cytosolic protein that may play a role in embryogenesis and perturbation of its function by genetic modification could potentially lead to developmental abnormalities(PMID:14600151).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10086 Product name: Recombinant human CA13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-262 aa of BC052602 Sequence: MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH Predict reactive species\nFull Name: carbonic anhydrase XIII\nCalculated Molecular Weight: 262 aa, 29 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC052602\nGene Symbol: CA13\nGene ID (NCBI): 377677\nRRID: AB_1850972\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N1Q1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869520449705,"sku":"16696-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16696-1-ap","provider":"Iright","version":"1.0","type":"link"}