{"product_id":"proteintech-16723-1-ap","title":"Proteintech, 16723-1-AP, ANTXR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANTXR2 (16723-1-AP) by Proteintech is a Polyclonal antibody targeting ANTXR2 in WB, IP, IHC, ELISA applications with reactivity to human samples\n16723-1-AP targets ANTXR2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, PC-3 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human ovary tissue, human kidney tissue,  human placenta tissue,  human testis tissue,  human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANTXR2 (anthrax toxin receptor 2), also known as CMG2 (capillary morphogenesis gene 2 protein) is a transmembrane protein that is induced during capillary morphogenesis. It contains a vWA domain that shows strong binding to laminin and collagen IV, suggesting that this protein plays a role in basement membrane matrix assembly and endothelial cell morphogenesis (PMID: 11683410; 14508707). Like its paralog TEM8 (ANTXR1), ANTXR2 also functions as a receptor for anthrax toxin. Mutations in ANTXR2 result in the allelic disorders juvenile hyaline fibromatosis and infantile systemic hyalinosis (PMID: 14508707; 12973667; 22383261).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, camelus bactrianus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10162 Product name: Recombinant human ANTXR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-231 aa of BC107876 Sequence: ISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSL Predict reactive species\nFull Name: anthrax toxin receptor 2\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC107876\nGene Symbol: ANTXR2\nGene ID (NCBI): 118429\nRRID: AB_2056741\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58335\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938784937,"sku":"16723-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16723-1-ap","provider":"Iright","version":"1.0","type":"link"}