{"product_id":"proteintech-16735-1-ap","title":"Proteintech, 16735-1-AP, MRPS16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPS16 (16735-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS16 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16735-1-AP targets MRPS16 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells,  HepG2 cells,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9749 Product name: Recombinant human MRPS16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC021106 Sequence: MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET Predict reactive species\nFull Name: mitochondrial ribosomal protein S16\nCalculated Molecular Weight: 137 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC021106\nGene Symbol: MRPS16\nGene ID (NCBI): 51021\nRRID: AB_2180166\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3D3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876755113,"sku":"16735-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16735-1-ap","provider":"Iright","version":"1.0","type":"link"}