{"product_id":"proteintech-16762-1-ap","title":"Proteintech, 16762-1-AP, AGPAT6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AGPAT6 (16762-1-AP) by Proteintech is a Polyclonal antibody targeting AGPAT6 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16762-1-AP targets AGPAT6 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse testis tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human testis tissue,  human kidney tissue,  human liver tissue,  human ovary tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAGPAT6 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase (AGPAT) family. AGPAT6 is expressed in brown adipose tissue and mammary epithelium as well as many other tissues. A deficiency of AGPAT6 in mice results in resistance to dietinduced and genetic forms of obesity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10294 Product name: Recombinant human AGPAT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 206-456 aa of BC051377 Sequence: KEFMSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS Predict reactive species\nFull Name: 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta)\nCalculated Molecular Weight: 456 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC051377\nGene Symbol: AGPAT6\nGene ID (NCBI): 137964\nRRID: AB_1850878\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UL3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869512618153,"sku":"16762-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16762-1-ap","provider":"Iright","version":"1.0","type":"link"}