{"product_id":"proteintech-16777-1-ap","title":"Proteintech, 16777-1-AP, NEDD8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEDD8 (16777-1-AP) by Proteintech is a Polyclonal antibody targeting NEDD8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples\n16777-1-AP targets NEDD8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, human heart tissue,  mouse brain tissue,  PC-12 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEDD8 (neural precursor cell-expressed developmentally down-regulated gene 8) is a small ubiquitin-like protein that shares 60% sequence identity and 80% homology with ubiquitin [PMID:9353319]. NEDD8 is conjugated to substrate proteins in a process known as neddylation. NEDD8 forms a thioester bond with APPBP1-Uba3, the E1 enzyme. Activated NEDD8 then transfers to Ubc12, the E2 enzyme . Ultimately, E2 loaded with NEDD8 binds a substrate protein lysine residue and forms an isopeptide bond by E3 ligase [PMID:18802447].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10154 Product name: Recombinant human NEDD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC104664 Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ Predict reactive species\nFull Name: neural precursor cell expressed, developmentally down-regulated 8\nCalculated Molecular Weight: 81 aa, 9 kDa\nObserved Molecular Weight: 6-10 kDa\nGenBank Accession Number: BC104664\nGene Symbol: NEDD8\nGene ID (NCBI): 4738\nRRID: AB_10598467\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15843\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943274153,"sku":"16777-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16777-1-ap","provider":"Iright","version":"1.0","type":"link"}