{"product_id":"proteintech-16794-1-ap","title":"Proteintech, 16794-1-AP, PRKRIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRKRIP1 (16794-1-AP) by Proteintech is a Polyclonal antibody targeting PRKRIP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n16794-1-AP targets PRKRIP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, L02 cells\nPositive IP detected in: NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRKR-interacting protein 1 (PRKRIP1), a component of the splicing C complex, is a double-stranded RNA-binding protein. PRKRIP1 consists of a fully extended N-terminal loop (residues 51-75) and an 18-turn α helix (residues 76-142) that spans 100 Å (PMID: 28502770). The full-length cDNA contains an open reading frame of 561 bp, which encodes an 184-amino acid polypeptide with a predicted molecular mass of 21 kDa (PMID: 12679338).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10266 Product name: Recombinant human PRKRIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC014298 Sequence: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR Predict reactive species\nFull Name: PRKR interacting protein 1 (IL11 inducible)\nCalculated Molecular Weight: 184 aa, 21 kDa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: BC014298\nGene Symbol: PRKRIP1\nGene ID (NCBI): 79706\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H875\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887773569193,"sku":"16794-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16794-1-ap","provider":"Iright","version":"1.0","type":"link"}