{"product_id":"proteintech-16805-1-ap","title":"Proteintech, 16805-1-AP, RPLP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPLP2 (16805-1-AP) by Proteintech is a Polyclonal antibody targeting RPLP2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n16805-1-AP targets RPLP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, mouse liver tissue\nPositive IHC detected in: mouse kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10293 Product name: Recombinant human RPLP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC062314 Sequence: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD Predict reactive species\nFull Name: ribosomal protein, large, P2\nCalculated Molecular Weight: 115 aa, 12 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC062314\nGene Symbol: RPLP2\nGene ID (NCBI): 6181\nRRID: AB_2878318\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05387\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869590081705,"sku":"16805-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16805-1-ap","provider":"Iright","version":"1.0","type":"link"}