{"product_id":"proteintech-16812-1-ap","title":"Proteintech, 16812-1-AP, LMF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LMF1 (16812-1-AP) by Proteintech is a Polyclonal antibody targeting LMF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16812-1-AP targets LMF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLMF1, also named as C16orf26 and TMEM112, is involved in the maturation of lipoprotein lipase (LPL) and hepatic lipase in endoplasmic reticulum. It is required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10349 Product name: Recombinant human LMF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-486 aa of BC010738 Sequence: VRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVILQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWIIHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRIGAYFPPLSLEELRPYFRDRGWPL Predict reactive species\nFull Name: lipase maturation factor 1\nCalculated Molecular Weight: 567 aa, 65 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC010738\nGene Symbol: LMF1\nGene ID (NCBI): 64788\nRRID: AB_2878320\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96S06\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869703786665,"sku":"16812-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16812-1-ap","provider":"Iright","version":"1.0","type":"link"}