{"product_id":"proteintech-16820-1-ap","title":"Proteintech, 16820-1-AP, ZC3HAV1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZC3HAV1 (16820-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3HAV1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n16820-1-AP targets ZC3HAV1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe zinc-finger antiviral protein (ZAP) was originally identifed from a rat cDNA library due to its conferring resistance to retroviruses. ZC3HAV1 is a CCCH-type zinc finger protein, it may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms. ZC3HAV1 exists some isoforms with MV 101, 77, 67, 42 and 18 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10364 Product name: Recombinant human ZC3HAV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC025308 Sequence: MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLAS Predict reactive species\nFull Name: zinc finger CCCH-type, antiviral 1\nCalculated Molecular Weight: 699aa,78 kDa; 902aa,101 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC025308\nGene Symbol: ZC3HAV1\nGene ID (NCBI): 56829\nRRID: AB_2728733\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z2W4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868854767785,"sku":"16820-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16820-1-ap","provider":"Iright","version":"1.0","type":"link"}