{"product_id":"proteintech-16842-1-ap","title":"Proteintech, 16842-1-AP, HEBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HEBP1 (16842-1-AP) by Proteintech is a Polyclonal antibody targeting HEBP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16842-1-AP targets HEBP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, A549 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHEBP1 (heme binding protein 1) is an intracellular tetrapyrrole-binding protein. Catalog#16842-1-AP is a rabbit polyclonal antibody raised against the full-length of human HEBP1. The MW of this protein is 21 kDa, and this antibody specially recognises the 21 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10538 Product name: Recombinant human HEBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC016277 Sequence: MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT Predict reactive species\nFull Name: heme binding protein 1\nCalculated Molecular Weight: 189 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC016277\nGene Symbol: HEBP1\nGene ID (NCBI): 50865\nRRID: AB_2117378\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRV9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887666155689,"sku":"16842-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16842-1-ap","provider":"Iright","version":"1.0","type":"link"}