{"product_id":"proteintech-16845-1-ap","title":"Proteintech, 16845-1-AP, Apolipoprotein A II\/APOA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Apolipoprotein A II\/APOA2 (16845-1-AP) by Proteintech is a Polyclonal antibody targeting Apolipoprotein A II\/APOA2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n16845-1-AP targets Apolipoprotein A II\/APOA2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue\nPositive IP detected in: human plasma tissue\nPositive IHC detected in: human liver tissue, human colon tissue,  human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ\/ATQ, heterodimer apoA2-ATQ\/AT, homodimer apoA2-AT\/AT, apoA2-AT\/A, and apoA2-A\/A. ApoA2 isoforms are considered to be some of the most promising serum\/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9863 Product name: Recombinant human APOA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC005282 Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Predict reactive species\nFull Name: apolipoprotein A-II\nCalculated Molecular Weight: 100 aa, 11 kDa\nObserved Molecular Weight: 7-9 kDa (monomer), 15 kDa (dimer)\nGenBank Accession Number: BC005282\nGene Symbol: APOA2\nGene ID (NCBI): 336\nRRID: AB_2878324\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02652\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869444067497,"sku":"16845-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16845-1-ap","provider":"Iright","version":"1.0","type":"link"}