{"product_id":"proteintech-16902-1-ap","title":"Proteintech, 16902-1-AP, NDUFB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB1 (16902-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n16902-1-AP targets NDUFB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, mouse heart tissue,  human colon tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10443 Product name: Recombinant human NDUFB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-69 aa of BC009691 Sequence: VAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa\nCalculated Molecular Weight: 12 kDa, 7 kDa\nObserved Molecular Weight: 7 kDa\nGenBank Accession Number: BC009691\nGene Symbol: NDUFB1\nGene ID (NCBI): 4707\nRRID: AB_2150787\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75438\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869476409513,"sku":"16902-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16902-1-ap","provider":"Iright","version":"1.0","type":"link"}