{"product_id":"proteintech-16906-1-ap","title":"Proteintech, 16906-1-AP, PIGT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIGT (16906-1-AP) by Proteintech is a Polyclonal antibody targeting PIGT in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n16906-1-AP targets PIGT in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, A549 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIGT is a subunit of the glycosylphosphatidylinositol transamidase complex that catalyzes the attachment of proteins to GPI-anchors. GPI-anchors are glycolipids found on membrane of diverse cells that help proteins anchoring to the cell surface. Mutations of PIGT have been linked to developmental disorders including multiple congenital anomalies-hypotonia-seizures syndrome-3. Multiple isoforms of PIGT exist due to the alternative splicing, with the predicted MWs ranging from 42 kDa to 66 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10521 Product name: Recombinant human PIGT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-578 aa of BC015022 Sequence: RCTSISWELRQTLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITTYNQDNETLEVHPPPTTTYQDVILGTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVPFLHAQRYVSGYGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQDRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCYGSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL Predict reactive species\nFull Name: phosphatidylinositol glycan anchor biosynthesis, class T\nCalculated Molecular Weight: 578 aa, 66 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC015022\nGene Symbol: PIGT\nGene ID (NCBI): 51604\nRRID: AB_2164836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969N2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869422997673,"sku":"16906-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16906-1-ap","provider":"Iright","version":"1.0","type":"link"}