{"product_id":"proteintech-16957-1-ap","title":"Proteintech, 16957-1-AP, MTERF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTERF (16957-1-AP) by Proteintech is a Polyclonal antibody targeting MTERF in WB, ELISA applications with reactivity to human, mouse, rat samples\n16957-1-AP targets MTERF in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial transcription termination factor (MTERF)also named as Mterf1 is a 399 amino acid protein, which localizes in the mitochondrion and belongs to the mTERF family. MTERF  contains three leucine zippers that form a three-stranded coiled-coil that binds to DNA. It has been suggested that only the phosphorylated form of MTERF has transcription termination activity. MTERF plays a central role in the control of mitochondrial rRNA and mRNA synthesis. MTERFD1 is also thought to act as a mitochondrial transcription regulator and is expressed as two isoforms produced by alternative splicing.Using DNA affinity chromatography, a fraction called MTERF was found to be associated with foot-printing capacity, and this contained two polypeptides of 34 and 31 kDa. Moreover, termination-promoting activity appears to reside in the 34-kDa protein. (PMID:7681833).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10640 Product name: Recombinant human MTERF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-399 aa of BC000965 Sequence: MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPTDFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA Predict reactive species\nFull Name: mitochondrial transcription termination factor\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC000965\nGene Symbol: MTERF\nGene ID (NCBI): 7978\nRRID: AB_2235580\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99551\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869474181289,"sku":"16957-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16957-1-ap","provider":"Iright","version":"1.0","type":"link"}