{"product_id":"proteintech-16974-1-ap","title":"Proteintech, 16974-1-AP, Frizzled 7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Frizzled 7 (16974-1-AP) by Proteintech is a Polyclonal antibody targeting Frizzled 7 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n16974-1-AP targets Frizzled 7 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue,  mouse heart tissue,  mouse kidney tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFrizzled class receptor 7 (Frizzled 7, also known as FZD7) is a member of the superfamily of G protein-coupled receptor proteins that act as receptors in the Wnt signaling pathway. Frizzled 7 plays a role in development, stem cell renewal, and differentiation and has been implicated in the progression of various cancers.What is the molecular weight of Frizzled 7? Is Frizzled 7 post-translationally modified?The molecular size of Frizzled 7 is ~63 kDa, which represents the mature N-glycosylated species (PMID: 25274627). Frizzled 7 can form homodimers and heterodimers with other Frizzled family members (PMID: 14688793).What is the subcellular localization of Frizzled 7?Frizzled 7 is a seven-pass transmembrane protein that is present at the plasma membrane. In endothelial cells, it predominantly locates to cell-cell junctions (PMID: 24866384). Frizzled 7 has a cleavage site for calpain-1 protease in its C-terminus that regulates its activity and plasma membrane turnover (PMID: 17716656).What is the tissue expression pattern of Frizzled 7?Frizzled 7 is expressed at high levels in adult skeletal muscles and in fetal kidneys, but is also present in fetal lung, adult heart, brain, and placenta (PMID: 9813155). Frizzled 7 expression is increased in various cancer types, including melanoma, hepatocellular carcinoma, lung, esophageal, gastric, and colon cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9446 Product name: Recombinant human FZD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-257 aa of BC015915 Sequence: QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWV Predict reactive species\nFull Name: frizzled homolog 7 (Drosophila)\nCalculated Molecular Weight: 574 aa, 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC015915\nGene Symbol: Frizzled 7\nGene ID (NCBI): 8324\nRRID: AB_2294535\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75084\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893630633,"sku":"16974-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-16974-1-ap","provider":"Iright","version":"1.0","type":"link"}