{"product_id":"proteintech-17020-1-ap","title":"Proteintech, 17020-1-AP, PPM1F Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPM1F (17020-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1F in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n17020-1-AP targets PPM1F in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, L02 cells,  HepG2 cells,  human liver tissue,  K-562 cells,  HeLa cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human ovary cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMg2+\/Mn2+-dependent protein phosphatase 1F (PPM1F) belongs to the PP2C family of Ser\/Thr protein phosphatases and is the critical enzyme responsible for dephosphorylating the threonine motif. PPM1F is ubiquitous in various tissues and organs (PMID: 26498692). High expression of PPM1F was positively associated with poor survival and tumor recurrence in patients with cancers and PPM1F might be a potential biomarker in HCC patients (PMID: 30470261).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10186 Product name: Recombinant human PPM1F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-453 aa of BC071989 Sequence: EEEEDDDEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS Predict reactive species\nFull Name: protein phosphatase 1F (PP2C domain containing)\nCalculated Molecular Weight: 453 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC071989\nGene Symbol: PPM1F\nGene ID (NCBI): 9647\nRRID: AB_2284338\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49593\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869576155305,"sku":"17020-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17020-1-ap","provider":"Iright","version":"1.0","type":"link"}