{"product_id":"proteintech-17036-1-ap","title":"Proteintech, 17036-1-AP, RWDD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RWDD1 (17036-1-AP) by Proteintech is a Polyclonal antibody targeting RWDD1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17036-1-AP targets RWDD1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse thymus tissue,  HeLa cells,  Jurkat cells,  rat thymus tissue\nPositive IP detected in: mouse thymus tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRWDD1(RWD domain-containing protein 1) is also named as DFRP2(DRG family-regulatory protein 2) and belongs to the RWDD1\/GIR2 family. RWDD1 is a thymus aging-related protein which contains an RWD domain at its N-terminus and it is expressed in both thymocytes and thymic epithelial cells and located primarily in the cytoplasm. This protein expression in thymus is decreased in aged and oxidatively stressed mice (PMID:18954556). RWDD1 has a calculated molecular mass of 28 kDa, and apparent molecular mass of 32-36 kDa due to its high acidic amino acid composition that results in the slowed migration behavior in electrophoresis (PMID: 30278355, 18954556).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10525 Product name: Recombinant human RWDD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC015802 Sequence: MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESDSAD Predict reactive species\nFull Name: RWD domain containing 1\nCalculated Molecular Weight: 243 aa, 28 kDa\nObserved Molecular Weight: 28-36 kDa\nGenBank Accession Number: BC015802\nGene Symbol: RWDD1\nGene ID (NCBI): 51389\nRRID: AB_2184704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H446\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869759656105,"sku":"17036-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17036-1-ap","provider":"Iright","version":"1.0","type":"link"}