{"product_id":"proteintech-17037-1-ap","title":"Proteintech, 17037-1-AP, CHAF1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHAF1A (17037-1-AP) by Proteintech is a Polyclonal antibody targeting CHAF1A in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n17037-1-AP targets CHAF1A in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromatin assembly factor 1 (CAF1) is the only histone chaperone known to assemble histones H3 and H4 onto newly synthesized DNA both in vitro and in vivo [PMID:17065558]. The 938 amino acid multidomain p150 (CHAF1A) binds via its C-terminal third to p60, which is an essential step for nucleosome assembly because knocking down either subunit disrupts the activity [PMID:14519857]. In addition, CAF1 facilitates DNA synthesis depending on the binding of the N-terminal 31 residues of p150 to the proliferating cell nuclear antigen (PCNA), which acts as a sliding clamp to stimulate the processivity of DNA polymerase [PMID:10648606]. CHAF1A regulates the formation of heterochromatin in mammalian cells during replication and in plants it maintains the transcription of certain subsets of genes. Furthermore, CHAF1A exists in a chromatin-remodeling complex WINAC, which coactivates ligand-induced transactivation function of the vitamin D receptor [PMID:12837248].\nCHAF1A protein exists some phosphorylation sites, which may affect its theoretical molecular weight when tested.And a 150 kDa band was recognized (PMID:27445493).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10536 Product name: Recombinant human CHAF1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 607-956 aa of BC067093 Sequence: EEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS Predict reactive species\nFull Name: chromatin assembly factor 1, subunit A (p150)\nCalculated Molecular Weight: 956 aa, 107 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC067093\nGene Symbol: CHAF1A\nGene ID (NCBI): 10036\nRRID: AB_2291707\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868949794985,"sku":"17037-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17037-1-ap","provider":"Iright","version":"1.0","type":"link"}