{"product_id":"proteintech-17048-1-ap","title":"Proteintech, 17048-1-AP, STARD10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STARD10 (17048-1-AP) by Proteintech is a Polyclonal antibody targeting STARD10 in WB, IP, IHC, ELISA applications with reactivity to human samples\n17048-1-AP targets STARD10 in WB, IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, T-47D cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTARD10 (START domain-containing protein 10, also known as PCTP-like protein) is highly expressed in liver and responsible to transfer phosphatidylcholine. STARD10 was identified as a protein overexpressed in breast cancer that cooperates with the ErbB family of receptor tyrosine kinases in cellular transformation (PMID: 15911624). This antibody detected duplicate bands between 35-40 kDa (PMID: 15150109).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10705 Product name: Recombinant human STARD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-291 aa of BC007919 Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT Predict reactive species\nFull Name: StAR-related lipid transfer (START) domain containing 10\nCalculated Molecular Weight: 291 aa, 33 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC007919\nGene Symbol: STARD10\nGene ID (NCBI): 10809\nRRID: AB_2255485\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y365\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887817838761,"sku":"17048-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17048-1-ap","provider":"Iright","version":"1.0","type":"link"}