{"product_id":"proteintech-17056-1-ap","title":"Proteintech, 17056-1-AP, UBE2F Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2F (17056-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2F in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17056-1-AP targets UBE2F in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, Jurkat cells,  mouse ovary tissue,  rat ovary tissue\nPositive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE2F(Ubiquitin-conjugating enzyme E2 F) is also named as NCE2(NEDD8-conjugating enzyme 2) and belongs to the ubiquitin-conjugating enzyme family.The canonical uBE2M catalyses the modification of most cullins, whereas uBE2F is specifically responsible for cuL5 neddylation. uBE2F is regulated differently than uBE2M, supporting the idea that neddylation is used to fine-tune ubiquitin-chain formation by different cullin-dependent E3s(PMID:19465892).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10764 Product name: Recombinant human UBE2F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC010549 Sequence: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2F (putative)\nCalculated Molecular Weight: 185 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC010549\nGene Symbol: UBE2F\nGene ID (NCBI): 140739\nRRID: AB_2210295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969M7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961788073,"sku":"17056-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17056-1-ap","provider":"Iright","version":"1.0","type":"link"}