{"product_id":"proteintech-17067-1-ap","title":"Proteintech, 17067-1-AP, LARP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LARP7 (17067-1-AP) by Proteintech is a Polyclonal antibody targeting LARP7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17067-1-AP targets LARP7 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, human brain tissue,  NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissue, human placenta tissue,  human testis tissue,  human skin tissue,  human liver tissue,  human spleen tissue,  human stomach cancer tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation. binds to and stabilizes 7sk snRNA[PMID:19416841].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10891 Product name: Recombinant human LARP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-331 aa of BC006981 Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE Predict reactive species\nFull Name: La ribonucleoprotein domain family, member 7\nCalculated Molecular Weight: 582 aa, 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC006981\nGene Symbol: LARP7\nGene ID (NCBI): 51574\nRRID: AB_2132693\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4G0J3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868912963753,"sku":"17067-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17067-1-ap","provider":"Iright","version":"1.0","type":"link"}