{"product_id":"proteintech-17100-1-ap","title":"Proteintech, 17100-1-AP, DGAT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DGAT2 (17100-1-AP) by Proteintech is a Polyclonal antibody targeting DGAT2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17100-1-AP targets DGAT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse adipose tissue, L02 cells,  MCF-7 cells,  Neuro-2a cells,  mouse heart tissue,  mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDiacylglycerol acyltransferase 2 (DGAT2) is an integral membrane protein and major enzyme that catalyzes the final step of triacylglycerol (TG) synthesis in eukaryotes (PMID: 21680734). DGAT2 is present in mitochondria-associated membranes, specialized domains of the ER that are highly enriched in lipid synthetic enzymes (PMID: 19049983). DGAT2 isoforms (39 kDa, 44kDa) have major differences in acyl-CoA substrate specificity toward erucoyl-CoA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10719 Product name: Recombinant human DGAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-388 aa of BC015234 Sequence: DWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN Predict reactive species\nFull Name: diacylglycerol O-acyltransferase homolog 2 (mouse)\nCalculated Molecular Weight: 388 aa, 44 kDa\nObserved Molecular Weight: 39~44kDa\nGenBank Accession Number: BC015234\nGene Symbol: DGAT2\nGene ID (NCBI): 84649\nRRID: AB_2918049\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PD7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940226729,"sku":"17100-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17100-1-ap","provider":"Iright","version":"1.0","type":"link"}