{"product_id":"proteintech-17105-1-ap","title":"Proteintech, 17105-1-AP, GNPDA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNPDA2 (17105-1-AP) by Proteintech is a Polyclonal antibody targeting GNPDA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17105-1-AP targets GNPDA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat kidney tissue,  mouse kidney tissue\nPositive IHC detected in: human breast cancer tissue,  human spleen tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNPDA2(Glucosamine-6-phosphate deaminase 2) is also named as GNP2 and belongs to the glucosamine\/galactosamine-6-phosphate isomerase family. It catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Human GNPDA1 and GNPDA2  shared the same fold and were predicted to form hexameric particles(PMID:12965206). This protein has 5 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 29 kDa, 23 kDa and 27 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10780 Product name: Recombinant human GNPDA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC015532 Sequence: MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN Predict reactive species\nFull Name: glucosamine-6-phosphate deaminase 2\nCalculated Molecular Weight: 275 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC015532\nGene Symbol: GNPDA2\nGene ID (NCBI): 132789\nRRID: AB_2878350\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDQ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869545648297,"sku":"17105-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17105-1-ap","provider":"Iright","version":"1.0","type":"link"}