{"product_id":"proteintech-17116-1-ap","title":"Proteintech, 17116-1-AP, OMA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OMA1 (17116-1-AP) by Proteintech is a Polyclonal antibody targeting OMA1 in WB, IHC, ELISA applications with reactivity to human samples\n17116-1-AP targets OMA1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  K-562 cells,  HepG2 cells,  SKOV-3 cells,  MDA-MB-231 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOMA1 (Overlapping with the m-AAA protease 1 homolog) is also named as MPRP1 (Metalloprotease-related protein 1) and belongs to the peptidase M48 family. It is a zinc metalloprotease that spans the inner mitochondrial membrane with a number of predicted membrane spanning domains and the 60 kDa form of OMA1 rapidly accumulated concomitantly with the cleavage of all OPA1 variants, the 40 kDa form of OMA1 may be the mature form (M-OMA1), and the 35 kDa is a cleaved form (S-OMA1), with the 60 kDa form being the active enzyme (PMID:20334834, 30518622). This antibody is speicific to OMA1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10803 Product name: Recombinant human OMA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-524 aa of BC012915 Sequence: ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS Predict reactive species\nFull Name: OMA1 homolog, zinc metallopeptidase (S. cerevisiae)\nCalculated Molecular Weight: 524 aa, 60 kDa\nObserved Molecular Weight: 34, 60 kDa\nGenBank Accession Number: BC012915\nGene Symbol: OMA1\nGene ID (NCBI): 115209\nRRID: AB_2299053\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96E52\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855652521,"sku":"17116-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17116-1-ap","provider":"Iright","version":"1.0","type":"link"}