{"product_id":"proteintech-17160-1-ap","title":"Proteintech, 17160-1-AP, C4 Gamma Chain Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C4 Gamma Chain (17160-1-AP) by Proteintech is a Polyclonal antibody targeting C4 Gamma Chain in WB, IHC, ELISA applications with reactivity to human samples\n17160-1-AP targets C4 Gamma Chain in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular weights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1543-1744aa of human C4A protein recognizes the C4 gamma chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10449 Product name: Recombinant human C4A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-202 aa of BC012372 Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV Predict reactive species\nFull Name: complement component 4A (Rodgers blood group)\nCalculated Molecular Weight: 1744 aa, 193 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC012372\nGene Symbol: C4 Gamma Chain\nGene ID (NCBI): 720\nRRID: AB_2923565\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0C0L4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885610225833,"sku":"17160-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17160-1-ap","provider":"Iright","version":"1.0","type":"link"}