{"product_id":"proteintech-17163-1-ap","title":"Proteintech, 17163-1-AP, OATP14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OATP14 (17163-1-AP) by Proteintech is a Polyclonal antibody targeting OATP14 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n17163-1-AP targets OATP14 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  mouse brain tissue,  mouse kidney tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10573 Product name: Recombinant human OATP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-391 aa of BC022461 Sequence: VPFWYLPKSLPRSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLCTSTVQFNSLFGMVTYKPKYIEQQYGQSSSRA Predict reactive species\nFull Name: solute carrier organic anion transporter family, member 1C1\nCalculated Molecular Weight: 712 aa, 79 kDa\nObserved Molecular Weight: 62-70 kDa\nGenBank Accession Number: BC022461\nGene Symbol: SLCO1C1\nGene ID (NCBI): 53919\nRRID: AB_2189706\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYB5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869477949609,"sku":"17163-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17163-1-ap","provider":"Iright","version":"1.0","type":"link"}