{"product_id":"proteintech-17177-1-ap","title":"Proteintech, 17177-1-AP, DNAJB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJB3 (17177-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17177-1-AP targets DNAJB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IHC detected in: mouse testis tissue, human kidney tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10878 Product name: Recombinant human DNAJB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC024013 Sequence: MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily B, member 3\nCalculated Molecular Weight: 145 aa, 17 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC024013\nGene Symbol: DNAJB3\nGene ID (NCBI): 414061\nRRID: AB_2094420\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WWF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868954415273,"sku":"17177-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17177-1-ap","provider":"Iright","version":"1.0","type":"link"}