{"product_id":"proteintech-17178-1-ap","title":"Proteintech, 17178-1-AP, TNP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNP1 (17178-1-AP) by Proteintech is a Polyclonal antibody targeting TNP1 in WB, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n17178-1-AP targets TNP1 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IF-P detected in: mouse testis tissue\nPositive IF-Fro detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransition nuclear proteins (TNP1 and TNP2) are the major nuclear proteins that replace somatic histones during spermatogenesis. TNPs are required for normal chromatin condensation and functional sperm development, spermatogenesis was found to be compromised in both Tnp1 and Tnp2 null mice. TNP1, or TP1, localized in nucleus, is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines. Recently, TNP-1 was used as a germ cell marker in condensing spermatids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10890 Product name: Recombinant human TNP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC029516 Sequence: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL Predict reactive species\nFull Name: transition protein 1 (during histone to protamine replacement)\nCalculated Molecular Weight: 55 aa, 7 kDa\nObserved Molecular Weight: 6-10 kDa\nGenBank Accession Number: BC029516\nGene Symbol: TNP1\nGene ID (NCBI): 7141\nRRID: AB_2206757\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09430\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872659113,"sku":"17178-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17178-1-ap","provider":"Iright","version":"1.0","type":"link"}