{"product_id":"proteintech-17230-1-ap","title":"Proteintech, 17230-1-AP, TLR9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLR9 (17230-1-AP) by Proteintech is a Polyclonal antibody targeting TLR9 in IP, ELISA applications with reactivity to human samples\n17230-1-AP targets TLR9 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLR9, also known as CD289, is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents and mediate the production of cytokines necessary for the development of effective immunity. TLR9 is a nucleotide-sensing TLR that is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides (PMID:14716310). Upon CpG stimulation, it induces B-cell proliferation, activation, survival, and antibody production (PMID:23857366). TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion, and the inflammatory response (PMID:11564765, 17932028).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11071 Product name: Recombinant human TLR9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-353 aa of BC032713 Sequence: FLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAH Predict reactive species\nFull Name: toll-like receptor 9\nCalculated Molecular Weight: 1032 aa, 116 kDa\nObserved Molecular Weight: 120 kDa, 60 kDa\nGenBank Accession Number: BC032713\nGene Symbol: TLR9\nGene ID (NCBI): 54106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NR96\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869616885929,"sku":"17230-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17230-1-ap","provider":"Iright","version":"1.0","type":"link"}