{"product_id":"proteintech-17239-1-ap","title":"Proteintech, 17239-1-AP, Complement C6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Complement C6 (17239-1-AP) by Proteintech is a Polyclonal antibody targeting Complement C6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n17239-1-AP targets Complement C6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human blood\nPositive IP detected in: human plasma\nPositive IHC detected in: mouse liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe final consequence of complement activation is formation of the membrane attack complex (MAC), a multiprotein assembly that perforates cell membranes, forming transmembrane channels. C6 is 1 of 5 late-acting proteins of complement that participate in assembly and function of the MAC. The deduced C6 protein contains 934 amino acids, including a 21-amino acid N-terminal signal sequence and 2 N-glycosylation sites. Mutations in the C6 gene are associated with complement component-6 deficiency.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11083 Product name: Recombinant human C6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 586-934 aa of BC035723 Sequence: TRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA Predict reactive species\nFull Name: complement component 6\nCalculated Molecular Weight: 934 aa, 105 kDa\nObserved Molecular Weight: 105-120 kDa\nGenBank Accession Number: BC035723\nGene Symbol: C6\nGene ID (NCBI): 729\nRRID: AB_2878366\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13671\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964081833,"sku":"17239-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17239-1-ap","provider":"Iright","version":"1.0","type":"link"}