{"product_id":"proteintech-17250-1-ap","title":"Proteintech, 17250-1-AP, RB1CC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RB1CC1 (17250-1-AP) by Proteintech is a Polyclonal antibody targeting RB1CC1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17250-1-AP targets RB1CC1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  Jurkat cells,  MCF-7 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse brain tissue, human breast cancer tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRB1CC1, also named as RBICC or FIP200, is implicated in the regulation of RB1 expression and functions as a DNA-binding transcription factor. It is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. Its expression is, thus, a prerequisite for myogenic differentiation. Involved in autophagy. RB1CC1 is required for autophagosome formation. It is probably involved in the tumorigenesis of breast cancer. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human RB1CC1. the calculated molecular weight of RB1CC1 is 180 kDa, but the modified RB1CC1 is about 200 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10508 Product name: Recombinant human RB1CC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1241-1594 aa of BC017556 Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV Predict reactive species\nFull Name: RB1-inducible coiled-coil 1\nCalculated Molecular Weight: 1594 aa, 183 kDa\nObserved Molecular Weight: 200 kDa\nGenBank Accession Number: BC017556\nGene Symbol: RB1CC1\nGene ID (NCBI): 9821\nRRID: AB_10666428\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDY2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868827406505,"sku":"17250-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17250-1-ap","provider":"Iright","version":"1.0","type":"link"}