{"product_id":"proteintech-17268-1-ap","title":"Proteintech, 17268-1-AP, UGT3A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGT3A1 (17268-1-AP) by Proteintech is a Polyclonal antibody targeting UGT3A1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n17268-1-AP targets UGT3A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, mouse kidney tissue,  rat colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUGT3A1 (UDP Glycosyltransferase Family 3 Member A1) belongs to UDP-Glucuronosyltransferases (UGTs) superfamily. UGTs are membrane-bound enzymes localized at the subcellular level in the endoplasmic reticulum (ER) with an active site facing the lumenal side of the ER membrane. The genetic variation in UGT enzymes can modulate its regulation and expression, influencing UGT activity and resulting in pharmacological and physiologic effects. UGT3 family enzymes (UGT3A1 and UGT3A2) are expressed in the thymus, testis, and kidney, with a potential role in the metabolism of ursodeoxycholic acid during the treatment of cholestasis or gallstones.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11020 Product name: Recombinant human UGT3A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-252 aa of BC035012 Sequence: MLHQSGKFLIPDIKEEEKSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIMDSLKNENYDLVFVEAFDFCSFLIAEKLVKPFVAILPTTFGSLDFGLPSPLSYVPVFPSLLTDHMDFWGRVKNFLMFFSFSRSQWDMQSTFDNTIKEHFPEGSRPVLSHLLLKAELWFVNSDFAFDFARPLLPNTVYIGGLMEKPIKPVPQNGQPALFTTPSLFSSGVYPEPLRRL Predict reactive species\nFull Name: UDP glycosyltransferase 3 family, polypeptide A1\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC035012\nGene Symbol: UGT3A1\nGene ID (NCBI): 133688\nRRID: AB_2304309\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6NUS8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887916732585,"sku":"17268-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17268-1-ap","provider":"Iright","version":"1.0","type":"link"}