{"product_id":"proteintech-17282-1-ap","title":"Proteintech, 17282-1-AP, EIF4E3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF4E3 (17282-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4E3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17282-1-AP targets EIF4E3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  mouse heart tissue,  HepG2 cells\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF4E3, also known as Eukaryotic translation initiation factor 4E type 3, is a 224 amino acid protein, which recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis. EIF4E3 acts as a tissue-specific tumor suppressor. For instance, eIF4E3 inhibits expression of both mRNA export and translation targets of eIF4E1, consistent with its nuclear and cytoplasmic localization. Importantly, eIF4E3 overexpression represses oncogenic transformation. (PMID: 23587918).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11056 Product name: Recombinant human EIF4E3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC031289 Sequence: MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH Predict reactive species\nFull Name: eukaryotic translation initiation factor 4E family member 3\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24-30 kDa\nGenBank Accession Number: BC031289\nGene Symbol: EIF4E3\nGene ID (NCBI): 317649\nRRID: AB_2262162\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N5X7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868933476521,"sku":"17282-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17282-1-ap","provider":"Iright","version":"1.0","type":"link"}