{"product_id":"proteintech-17293-1-ap","title":"Proteintech, 17293-1-AP, GIMAP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GIMAP7 (17293-1-AP) by Proteintech is a Polyclonal antibody targeting GIMAP7 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n17293-1-AP targets GIMAP7 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IP detected in: Jurkat cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGIMAP7, also known as hIAN7 or IAN 7, is a transmembrane protein located in the endoplasmic reticulum and Golgi apparatus. GIMAP7 can promote oxidative stress and apoptosis in ovarian granulosa cells in Polycystic ovary syndrome by inhibiting the SHH signalling pathway(PMID: 36581994). The MW of this protein is 34 kDa, and this antibody specially recognises the 34 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11171 Product name: Recombinant human GIMAP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC027613 Sequence: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS Predict reactive species\nFull Name: GTPase, IMAP family member 7\nCalculated Molecular Weight: 300 aa, 35 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC027613\nGene Symbol: GIMAP7\nGene ID (NCBI): 168537\nRRID: AB_2111885\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NHV1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869408350377,"sku":"17293-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17293-1-ap","provider":"Iright","version":"1.0","type":"link"}