{"product_id":"proteintech-17317-1-ap","title":"Proteintech, 17317-1-AP, BAT5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAT5 (17317-1-AP) by Proteintech is a Polyclonal antibody targeting BAT5 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n17317-1-AP targets BAT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, mouse cerebellum tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman lymphocyte antigen B-associated transcript 5 (BAT5, also known as ABHD16A) is a 558 residue (63 kDa) protein encoded by 20 exons located on chromosome 6p21.33. BAT5 belongs to the α\/β-hydrolase domain (ABHD) containing family of metabolic serine hydrolases and possesses both an esterase catalytic triad and an acyltransferase domain (PMID: 25290914). BAT5 not only participates in lipid metabolism but is also involved in the regulation of inflammation and immunity. BAT5 is predicted to be an integral membrane protein with highest mRNA transcript levels in mouse tissues found in testis, heart, muscle, and brain (PMID: 23328280).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11287 Product name: Recombinant human BAT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-558 aa of BC031839 Sequence: SYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPWHL Predict reactive species\nFull Name: HLA-B associated transcript 5\nCalculated Molecular Weight: 558 aa, 63 kDa\nObserved Molecular Weight: 59~63 KdA\nGenBank Accession Number: BC031839\nGene Symbol: BAT5\nGene ID (NCBI): 7920\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95870\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885182308521,"sku":"17317-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17317-1-ap","provider":"Iright","version":"1.0","type":"link"}