{"product_id":"proteintech-17356-1-ap","title":"Proteintech, 17356-1-AP, CHDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHDH (17356-1-AP) by Proteintech is a Polyclonal antibody targeting CHDH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17356-1-AP targets CHDH in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, mouse kidney tissue,  mouse liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHDH(Choline dehydrogenase, mitochondrial) is also named as CDH,CHD and belongs to the GMC oxidoreductase family. CHDH is a member of the glucose-methanol-choline family of oxidoreductases, with each member containing a consensus FAD-binding domain. Many members of this oxidoreductase family are soluble proteins but mammalian CHDH is associated with the inner mitochondrial membrane(Handbook of vitamins,Robert B,2007). The full length protein(65 kDa) has a transit peptide of 29 amino acid and the mature CHDH is appropriately located in the inner mitochondria membrane(PMID:12951056). 17356-1-AP can also recognize the 45 kDa isoform X3 of CHDH.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10614 Product name: Recombinant human CHDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 244-594 aa of BC034502 Sequence: YLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR Predict reactive species\nFull Name: choline dehydrogenase\nCalculated Molecular Weight: 594 aa, 65 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC034502\nGene Symbol: CHDH\nGene ID (NCBI): 55349\nRRID: AB_2276253\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NE62\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868963754153,"sku":"17356-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17356-1-ap","provider":"Iright","version":"1.0","type":"link"}