{"product_id":"proteintech-17368-1-ap","title":"Proteintech, 17368-1-AP, SNRPA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPA1 (17368-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPA1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n17368-1-AP targets SNRPA1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells,  Jurkat cells,  MCF-7 cells,  Raji cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human lung tissue, human brain tissue,  human kidney tissue,  human liver tissue,  human ovary tissue,  human placenta tissue,  human spleen tissue,  human stomach cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall nuclear ribonucleoprotein polypeptide a-prime(SNRPA1) is part of the U2 snRNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. It may be required for cell division, and helps the A' protein to bind stem loop IV of U2 snRNA. This is a rabbit polyclonal antibody raised against the full length SNRPA1 of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10790 Product name: Recombinant human SNRPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC022816 Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptide A'\nCalculated Molecular Weight: 255 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC022816\nGene Symbol: SNRPA1\nGene ID (NCBI): 6627\nRRID: AB_2193724\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09661\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869385347241,"sku":"17368-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17368-1-ap","provider":"Iright","version":"1.0","type":"link"}