{"product_id":"proteintech-17397-1-ap","title":"Proteintech, 17397-1-AP, ZG16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZG16 (17397-1-AP) by Proteintech is a Polyclonal antibody targeting ZG16 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse samples\n17397-1-AP targets ZG16 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human colon tissue, mouse colon tissue\nPositive IHC detected in: mouse pancreas tissue, human colon cancer tissue,  human pancreas tissue,  mouse colon tissue,  mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue\nPositive IF-Fro detected in: mouse small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:600\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZymogen granule protein 16 (ZG16) has a Jacalin-like lectin domain, which is mainly expressed by mucus-secreting cells, including goblet cells in the intestine. It's reported that ZG16 expression was significantly decreased in colorectal cancer compared to normal tissue. ZG16 gene expression and copy number variations (CNV) were associated with multiple molecular and clinicopathological features of CRC including MSI, MLH1 silencing and so on. It's found that ZG16 is negatively correlated with lymphatic invasive and distant metastasis. Besides, overexpression of ZG16 blocks PD-L1 expression in colorectal cancer, and promotes NK cells survival and proliferation. Very importantly, ZG16 suppresses colorectal tumor growth via the immune system. (PMID: 33360840, 21893569)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11332 Product name: Recombinant human ZG16 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-167 aa of BC029149 Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC Predict reactive species\nFull Name: zymogen granule protein 16 homolog (rat)\nCalculated Molecular Weight: 167 aa, 18 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC029149\nGene Symbol: ZG16\nGene ID (NCBI): 653808\nRRID: AB_1939810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60844\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869510521001,"sku":"17397-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17397-1-ap","provider":"Iright","version":"1.0","type":"link"}