{"product_id":"proteintech-17410-1-ap","title":"Proteintech, 17410-1-AP, RIOK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RIOK2 (17410-1-AP) by Proteintech is a Polyclonal antibody targeting RIOK2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n17410-1-AP targets RIOK2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HCT 116 cells\nPositive IHC detected in: mouse brain tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRio-kinase 2 (RIOK2) is an atypical serine-threonine kinase that participates in the nuclear export and maturation steps of the pre-40S ribosomal complex to facilitate cytoplasmic translation. RIOK2 binds the pre-40S subunit and promotes its nuclear export by interaction with the CRM1 chaperone protein (PMID: 36661680, 28499923). High expression of RIOK2 has been linked to decreased overall survival in non-small cell lung cancer.. RIOK2's kinase activ DD-RIPK1-caspase-8 complex from lysosome to ER (PMID: 41249793).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9975 Product name: Recombinant human RIOK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-553 aa of BC000953 Sequence: QMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEKNRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWGE Predict reactive species\nFull Name: RIO kinase 2 (yeast)\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC000953\nGene Symbol: RIOK2\nGene ID (NCBI): 55781\nRRID: AB_2178093\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BVS4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887785136297,"sku":"17410-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17410-1-ap","provider":"Iright","version":"1.0","type":"link"}