{"product_id":"proteintech-17422-1-ap","title":"Proteintech, 17422-1-AP, KIF26B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF26B (17422-1-AP) by Proteintech is a Polyclonal antibody targeting KIF26B in WB, IHC, ELISA applications with reactivity to human, canine samples\n17422-1-AP targets KIF26B in WB, IHC, IF, ELISA applications and shows reactivity with human, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDCK cells, HEK-293 cells,  MCF-7 cells\nPositive IHC detected in: human kidney tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF26B is a member of kinesin-11 family and plays important role in embryogenesis. It is a downstram target of Sall1 and is essential for kidney development. KIF26B is also involved in tumorigenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, canine\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11446 Product name: Recombinant human KIF26B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-355 aa of BC042481 Sequence: AFSAVIHDKLQVPNTIRKAWNDRDNRCDICATHLNQLKQEAIQMVLTLEQAAGSEHYDASPCSPPPLSNIPTLVGSRHVGGLQQPRDWAFVPAPCATSNYTGFANKHGSKPSSLGVSNGAEKKSGSPTHQAKVSLQMATSPSNGNILNSVAIQAHQYLDGTWSLSRTNGVTLYPYQDSEALVTRGRGRLEDSAAAPALMSEDRGA Predict reactive species\nFull Name: kinesin family member 26B\nCalculated Molecular Weight: 2108aa,224 kDa; 162aa,17 kDa\nObserved Molecular Weight: 224-230 kDa\nGenBank Accession Number: BC042481\nGene Symbol: KIF26B\nGene ID (NCBI): 55083\nRRID: AB_2131762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2KJY2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902707369,"sku":"17422-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17422-1-ap","provider":"Iright","version":"1.0","type":"link"}