{"product_id":"proteintech-17453-1-ap","title":"Proteintech, 17453-1-AP, COQ5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COQ5 (17453-1-AP) by Proteintech is a Polyclonal antibody targeting COQ5 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n17453-1-AP targets COQ5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse liver tissue\nPositive IHC detected in: human heart tissue,  human brain tissue,  human kidney tissue,  human liver tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOQ5 catalyzes the only C-methylation involved in the biosynthesis of coenzyme Q (Q or ubiquinone) in humans and yeast Saccharomyces cerevisiae. In humans, mutations in several COQ genes cause primary Q deficiency, and a decrease in Q biosynthesis is associated with mitochondrial, cardiovascular, kidney and neurodegenerative diseases (PMID: 25152161). Endogenous human COQ5 protein primarily existed as a mature form (m-COQ5, ~32 kDa) without the mitochondrial targeting sequence (MTS) in the mitochondria of human cells, in addition to the minor precursor form (p-COQ5, 37 kDa) of the full-length protein (PMID: 27155576).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10203 Product name: Recombinant human COQ5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-327 aa of BC107874 Sequence: MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL Predict reactive species\nFull Name: coenzyme Q5 homolog, methyltransferase (S. cerevisiae)\nCalculated Molecular Weight: 327 aa, 37 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC107874\nGene Symbol: COQ5\nGene ID (NCBI): 84274\nRRID: AB_10547974\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5HYK3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939866281,"sku":"17453-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17453-1-ap","provider":"Iright","version":"1.0","type":"link"}