{"product_id":"proteintech-17471-1-ap","title":"Proteintech, 17471-1-AP, RNF32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF32 (17471-1-AP) by Proteintech is a Polyclonal antibody targeting RNF32 in WB, ELISA applications with reactivity to human, mouse, rat samples\n17471-1-AP targets RNF32 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRing Finger Protein 32 (RNF32) is a member of the RING finger protein family, characterized by a RING domain that functions as an E3 ubiquitin ligase. RNF32 is specifically expressed in testis and ovary. Studies indicate that RNF32 is expressed during spermatogenesis, most likely in spermatocytes and\/or in spermatids, suggesting a possible role in sperm formation (PMID: 11890671, PMID: 41167191).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11428 Product name: Recombinant human RNF32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-221 aa of BC028120 Sequence: NKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLR Predict reactive species\nFull Name: ring finger protein 32\nCalculated Molecular Weight: 362 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC028120\nGene Symbol: RNF32\nGene ID (NCBI): 140545\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0A6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887787004073,"sku":"17471-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17471-1-ap","provider":"Iright","version":"1.0","type":"link"}