{"product_id":"proteintech-17476-1-ap","title":"Proteintech, 17476-1-AP, CCR5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCR5 (17476-1-AP) by Proteintech is a Polyclonal antibody targeting CCR5 in IHC, ELISA applications with reactivity to human samples\n17476-1-AP targets CCR5 in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCR5 (also known as CD195) is a member of the beta chemokine receptor family. This protein is expressed by T cells and macrophages and is known to be an important co-receptor for macrophage-tropic viruses, including HIV, to enter host cells. The natural chemokine ligands that bind to CCR5 include MIP-1-alpha, MIP-1-beta, MCP-2, and RANTES.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, macaque\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11493 Product name: Recombinant human CCR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 257-352 aa of BC038398 Sequence: LNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL Predict reactive species\nFull Name: chemokine (C-C motif) receptor 5\nCalculated Molecular Weight: 352 aa, 41 kDa\nGenBank Accession Number: BC038398\nGene Symbol: CCR5\nGene ID (NCBI): 1234\nRRID: AB_10895966\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51681\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910637225,"sku":"17476-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17476-1-ap","provider":"Iright","version":"1.0","type":"link"}