{"product_id":"proteintech-17508-1-ap","title":"Proteintech, 17508-1-AP, NUDT3\/4\/10\/11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUDT3\/4\/10\/11 (17508-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT3\/4\/10\/11 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17508-1-AP targets NUDT3\/4\/10\/11 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUDT10 (nucleoside diphosphate linked moiety X-type motif 10), also named as DIPP3A or APS2, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α\/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3\/4\/10\/11).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11711 Product name: Recombinant human NUDT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC050700 Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP Predict reactive species\nFull Name: nudix (nucleoside diphosphate linked moiety X)-type motif 10\nCalculated Molecular Weight: 164 aa, 19 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC050700\nGene Symbol: NUDT10\nGene ID (NCBI): 170685\nRRID: AB_2154145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NFP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887744307369,"sku":"17508-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17508-1-ap","provider":"Iright","version":"1.0","type":"link"}