{"product_id":"proteintech-17510-1-ap","title":"Proteintech, 17510-1-AP, Histone H1.0 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H1\n17510-1-AP targets Histone H1.0 in WB, IHC, IF\/ICC, IF-P, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  A431 cells,  mouse spleen tissue,  rat spleen tissue\nPositive IP detected in: A431 cells\nPositive IHC detected in: skin cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\nPositive IF\/ICC detected in: MCF-7 cells\nPositive ChIP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nChromatin immunoprecipitation (ChIP): CHIP : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in \neukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each \nof the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a \nlinker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures.Linker histones are \ninvolved in the formation of higher order structure in chromatin and the maintenance of overall chromatin compaction. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell \ndivision.Histone H1.0 (H1F0,H1FV) is a linker histone that is widely expressed in many tissues and almost all vertebrates, \nunlike some other linker histones. The observed molecular weight of H1F0 is about 32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9982 Product name: Recombinant human Histone H1.0 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC000145 Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK Predict reactive species\nFull Name: H1 histone family, member 0\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC000145\nGene Symbol: Histone H1.0\nGene ID (NCBI): 3005\nRRID: AB_10695628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07305\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868882063529,"sku":"17510-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17510-1-ap","provider":"Iright","version":"1.0","type":"link"}