{"product_id":"proteintech-17532-1-ap","title":"Proteintech, 17532-1-AP, CTDSPL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTDSPL2 (17532-1-AP) by Proteintech is a Polyclonal antibody targeting CTDSPL2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17532-1-AP targets CTDSPL2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  HeLa cells,  HepG2 cells,  human brain tissue,  mouse eye tissue,  mouse testis tissue,  Y79 cells\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTD small phosphatase-like protein 2 (CTDSPL2) is also named as HSPC058 and HSPC129, belongs to the CTDSPL2 family. It is a putative RNA-polymerase II carboxy-terminal domain (CTD) phosphatase, whose specific CTD phosphatase activity was verified in vitro, and may regulate the dynamic phosphorylation of RNAP II CTD.( PMID: 17487459) It can obviously improve the expression of ε- and γ-globin genes in K562 cells and CD34+ cells derived from UCB.( PMID: 20932329) This antibody is a rabbit polyclonal antibody raised against a region of human CTDSPL2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11581 Product name: Recombinant human CTDSPL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 114-466 aa of BC035744 Sequence: EMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD Predict reactive species\nFull Name: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2\nCalculated Molecular Weight: 466 aa, 53 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC035744\nGene Symbol: CTDSPL2\nGene ID (NCBI): 51496\nRRID: AB_2087204\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05D32\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996227241,"sku":"17532-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17532-1-ap","provider":"Iright","version":"1.0","type":"link"}