{"product_id":"proteintech-17589-1-ap","title":"Proteintech, 17589-1-AP, ATP5H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP5H (17589-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5H in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n17589-1-AP targets ATP5H in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse liver tissue,  rat brain tissue,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human lung cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5H gene encodes ATP synthase subunit d of the Fo complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11429 Product name: Recombinant human ATP5H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC032245 Sequence: MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d\nCalculated Molecular Weight: 137 aa, 16 kDa\nObserved Molecular Weight: 19-22 kDa\nGenBank Accession Number: BC032245\nGene Symbol: ATP5H\nGene ID (NCBI): 10476\nRRID: AB_2062046\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75947\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868963033257,"sku":"17589-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17589-1-ap","provider":"Iright","version":"1.0","type":"link"}