{"product_id":"proteintech-17600-1-ap","title":"Proteintech, 17600-1-AP, MTMR15\/FAN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTMR15\/FAN1 (17600-1-AP) by Proteintech is a Polyclonal antibody targeting MTMR15\/FAN1 in WB, IP, ELISA applications with reactivity to human samples\n17600-1-AP targets MTMR15\/FAN1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human spleen tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTMR15, also named as FAN1 and KIAA1018, is a nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. It is specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates. MTMR15 has some isoforms with MW 114 kDa and 60 kDa. The MW will be migrated to 120-140 kDa and 63-68 kDa with modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11651 Product name: Recombinant human MTMR15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 186-534 aa of BC047882 Sequence: STVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRESKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVRLFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRFCWLLLQ Predict reactive species\nFull Name: myotubularin related protein 15\nCalculated Molecular Weight: 60 kDa, 114 kDa\nObserved Molecular Weight: 63-68 kDa, 120-140 kDa\nGenBank Accession Number: BC047882\nGene Symbol: MTMR15\nGene ID (NCBI): 22909\nRRID: AB_10598016\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2M0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869416968361,"sku":"17600-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17600-1-ap","provider":"Iright","version":"1.0","type":"link"}