{"product_id":"proteintech-17614-1-ap","title":"Proteintech, 17614-1-AP, NDUFB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB2 (17614-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17614-1-AP targets NDUFB2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse spleen tissue,  human heart tissue,  mouse heart tissue,  rat heart tissue,  HuH-7 cells,  MCF-7 cells,  mouse brain tissue,  mouse kidney tissue\nPositive IHC detected in: mouse brain tissue, human brain tissue,  human heart tissue,  human kidney tissue,  human liver tissue,  human ovary tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. NDUFB2, also named as CI-AGGG, is a nuclear encoded subunit located in the hydrophobic protein fraction of complex I(PMID:9878551). It may have a role in the regulation of molecular changes during the global cardiac ischemia\/reperfusion injury during cardiopulmonary bypass (CPB). The full length 12 kDa protein has a transit peptide with 33 amino acids.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11789 Product name: Recombinant human NDUFB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC063026 Sequence: MESHERQPLVLHEEMGECRSSLSAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa\nCalculated Molecular Weight: 95 aa, 11 kDa\nObserved Molecular Weight: 8-12 kDa\nGenBank Accession Number: BC063026\nGene Symbol: NDUFB2\nGene ID (NCBI): 4708\nRRID: AB_2150944\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95178\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869716959401,"sku":"17614-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-17614-1-ap","provider":"Iright","version":"1.0","type":"link"}